PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0248s0400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 692aa    MW: 76485 Da    PI: 6.0326
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0248s0400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS314.81.8e-963376904374
                    GRAS   4 lLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                              + ++Ae +++g+   aq +Larl+++ + p g+p qR a+yf+ AL+  l+          ++s ++  n + ++ a+k fse+sP
  SapurV1A.0248s0400.1.p 337 PICQAAELIETGNPVHAQGILARLNHQlSLPIGNPYQRTAFYFKDALQLLLHT--------SNSSIDNACNLIFKIGAYKSFSELSP 415
                             5789*********************99788999******************99........344444556799************** PP

                    GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpf 176
                             il+f+++t+Nq +le +eg er+Hi+Dfdi++G+QW++L+q+La R++g+psl+iT+++sp+s ++ el  t+e+L+ fA+e+++pf
  SapurV1A.0248s0400.1.p 416 ILQFANFTCNQVLLEVFEGFERIHIVDFDIGYGGQWASLMQELALRAGGAPSLKITAFASPSSLDELELGFTRENLRIFASEINMPF 502
                             *************************************************************************************** PP

                    GRAS 177 efnvlvakrledl.eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerfleale 262
                             e ++l  ++l +   +  Lr+ ++E++aVnl +   ++ +++ +l+      L++vk+lsP+vvv  e+ +d+++ +F++++ +a++
  SapurV1A.0248s0400.1.p 503 ELEILNLESLGSGsWPMPLRMPEKEVTAVNLPIG--SFSNDPSTLPL----ALRFVKHLSPNVVVSLERGCDRSDLPFAHHVNHAIQ 583
                             *****77766665257789*************95..55555666665....************************************ PP

                    GRAS 263 yysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgy 349
                              ys+l++sl+a    + ++ +k+Er+l+++ i+++v  ++++     e+   Wr  + ++GF+p+++s+++++qa++l+++++++g+
  SapurV1A.0248s0400.1.p 584 SYSTLLESLDAV-NVNPDALQKIERFLVQPGIEKIVLGRHRS----PERTPPWRTLFLQSGFTPLTFSNFTESQAEYLVKRTPVRGF 665
                             *********665.34668999****************99998....9999************************************* PP

                    GRAS 350 rveeesgslvlgWkdrpLvsvSaWr 374
                             +ve+++ slvl+W+++ L+++SaWr
  SapurV1A.0248s0400.1.p 666 HVEKRQSSLVLCWQRKDLIAASAWR 690
                             ************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.191308670IPR005202Transcription factor GRAS
PfamPF035146.3E-94337690IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MKAMPLPFES FQGKGVLDFA SSTTSSPDSL HQYRHQWQNN SSKESCGFFV GSTEPTSVLD  60
TISRQSPPTS SSTLSYSQGG GGASTDTTNG VAASGGSNPC VDEKCGQQLG MEDWESVLPG  120
SPSQEQSILR LIMGDIEDPS TGLNKLLQSG SRSLDMEHGS GFGVVDQVFG FDISNMSSAS  180
ANLVANNNNI DPSSIHGINL LPGLFQQQQQ QAAFDQDEKP QILNPGMISN QNQHQFVQNS  240
ATLLPFSYSP LQEHHNNQHF LSPPPSKRIN SGPVGVNYVP KVFDSRPPEM FLPRQHQQQQ  300
QNHQFQLLQQ HQQRQGMITN DHELANQQQL QQAIINPICQ AAELIETGNP VHAQGILARL  360
NHQLSLPIGN PYQRTAFYFK DALQLLLHTS NSSIDNACNL IFKIGAYKSF SELSPILQFA  420
NFTCNQVLLE VFEGFERIHI VDFDIGYGGQ WASLMQELAL RAGGAPSLKI TAFASPSSLD  480
ELELGFTREN LRIFASEINM PFELEILNLE SLGSGSWPMP LRMPEKEVTA VNLPIGSFSN  540
DPSTLPLALR FVKHLSPNVV VSLERGCDRS DLPFAHHVNH AIQSYSTLLE SLDAVNVNPD  600
ALQKIERFLV QPGIEKIVLG RHRSPERTPP WRTLFLQSGF TPLTFSNFTE SQAEYLVKRT  660
PVRGFHVEKR QSSLVLCWQR KDLIAASAWR C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2836969037375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2118040.0AC211804.1 Populus trichocarpa clone POP017-B20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011033489.10.0PREDICTED: scarecrow-like protein 22 isoform X1
RefseqXP_011033496.10.0PREDICTED: scarecrow-like protein 22 isoform X1
TrEMBLU5FPJ80.0U5FPJ8_POPTR; Uncharacterized protein
STRINGPOPTR_0014s05910.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF31833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-149GRAS family protein